Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF726 Peptide - N-terminal region

ZNF726 Peptide - N-terminal region

Product Specifications

UniProt

A6NNF4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF726 Rabbit Polyclonal Antibody (orb55738) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001230967.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLSHKTQHKSIYTREKSYKCKKCGKTFNWSSILTNNKKIHTEQKPYKCEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP4C Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2400707 100 µL

PPP4C Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Tlr3 Mouse shRNA Plasmid (Locus ID 142980)
TL506043 1 Kit

Tlr3 Mouse shRNA Plasmid (Locus ID 142980)

Sign In for Pricing
View Details
Clusterin Rabbit Monoclonal Antibody
AMRe87059-01 1 Each

Clusterin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Clusterin Rabbit Monoclonal Antibody
AMRe87059-02 50 µL

Clusterin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Clusterin Rabbit Monoclonal Antibody
AMRe87059-03 100 µL

Clusterin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Ypel5 Mouse qPCR Primer Pair (NM_027166)
MP218647 200 Reactions

Ypel5 Mouse qPCR Primer Pair (NM_027166)

Sign In for Pricing
View Details