Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT19 Peptide - middle region

KRT19 Peptide - middle region

Product Specifications

Product Name Alternative

CK19, K19, K1CS

UniProt

P08727

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT19 Rabbit Polyclonal Antibody (orb578188) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002267

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCGC00238624
T206947-01 10 mg

NCGC00238624

Sign In for Pricing
View Details
NCGC00238624
T206947-02 50 mg

NCGC00238624

Sign In for Pricing
View Details
SLC25A20 Rabbit Polyclonal Antibody
E10G05298 100 µL

SLC25A20 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Acetyl/Phospho-Histone H3 (Lys9/Ser10) Polyclonal Antibody
TMAB-07099-01 50 μL

Anti-Acetyl/Phospho-Histone H3 (Lys9/Ser10) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Acetyl/Phospho-Histone H3 (Lys9/Ser10) Polyclonal Antibody
TMAB-07099-02 100 µL

Anti-Acetyl/Phospho-Histone H3 (Lys9/Ser10) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Acetyl/Phospho-Histone H3 (Lys9/Ser10) Polyclonal Antibody
TMAB-07099-03 200 µL

Anti-Acetyl/Phospho-Histone H3 (Lys9/Ser10) Polyclonal Antibody

Sign In for Pricing
View Details