Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT19 Peptide - middle region

KRT19 Peptide - middle region

Product Specifications

Product Name Alternative

CK19, K19, K1CS

UniProt

P08727

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT19 Rabbit Polyclonal Antibody (orb578188) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002267

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-30d-3p inhibitor
HY-RI00541-01 5 nmol

Hsa-miR-30d-3p inhibitor

Sign In for Pricing
View Details
Hsa-miR-30d-3p inhibitor
HY-RI00541-02 20 nmol

Hsa-miR-30d-3p inhibitor

Sign In for Pricing
View Details
6-HEX
C8312-10 10 mg

6-HEX

Sign In for Pricing
View Details
TFRC Antibody (CF488)
orb3073866 0.5 mL

TFRC Antibody (CF488)

Sign In for Pricing
View Details
SF4 Rabbit Polyclonal Antibody
E10G31708 100 µL

SF4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rln1 (NM_011272) Mouse Tagged Lenti ORF Clone
MR222296L4 10 µg

Rln1 (NM_011272) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details