Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR56B1 Peptide - middle region

OR56B1 Peptide - middle region

Product Specifications

Product Name Alternative

OR11-65, OR56B1P

UniProt

Q8NGI3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR56B1 Rabbit Polyclonal Antibody (orb587696) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005180

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILKATLFMVLRNGLFVTPVPVLAAQRDYCSKNEIEHCLCSNLGVTSLACD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMRT2 CRISPR/Cas9 KO Plasmid (h)
sc-408189 20 µg

DMRT2 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
PEX16 ORF Vector (Human) (pORF)
ORF007712 1.0 µg DNA

PEX16 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Ibrutinib Impurity 106
RM-I182106-01 10 mg

Ibrutinib Impurity 106

Sign In for Pricing
View Details
Ibrutinib Impurity 106
RM-I182106-02 25 mg

Ibrutinib Impurity 106

Sign In for Pricing
View Details
Ibrutinib Impurity 106
RM-I182106-03 50 mg

Ibrutinib Impurity 106

Sign In for Pricing
View Details
Ibrutinib Impurity 106
RM-I182106-04 100 mg

Ibrutinib Impurity 106

Sign In for Pricing
View Details