OR56B1 Peptide - middle region
OR56B1 Peptide - middle region
Product Specifications
Product Name Alternative
OR11-65, OR56B1P
UniProt
Q8NGI3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR56B1 Rabbit Polyclonal Antibody (orb587696) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005180
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ILKATLFMVLRNGLFVTPVPVLAAQRDYCSKNEIEHCLCSNLGVTSLACD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
349287 1 Kit
Genesig Real-Time PCR detection kit for Mycoplasma gallisepticum, Advanced
Sign In for Pricing
View Details 
MBS7198791 Inquire
Rabbit anti-Oryza sativa subsp. japonica (Rice) ML3 Polyclonal Antibody
Sign In for Pricing
View Details