MYB Peptide - C-terminal region
MYB Peptide - C-terminal region
Product Specifications
UniProt
P10242
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MYB Rabbit Polyclonal Antibody (orb329997) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AFTVPKNRSLASPLQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSART
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP17575PU-N 400 µL
n-Myc (MYCN) (C-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
![MLD Recombinant Rabbit Monoclonal Antibody [PSH02-54]](https://cdn.genprice.uk/products/992/68dd1c8c061270361ea81c1e/imageurl/ha721830.webp)
HA721830 100 µL
MLD Recombinant Rabbit Monoclonal Antibody [PSH02-54]
Sign In for Pricing
View Details