Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF187 Peptide - C-terminal region

RNF187 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RACO-1, RACO1

UniProt

Q5TA31

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RNF187 Rabbit Polyclonal Antibody (orb587740) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001010858

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ESAAAVWKGHVMDRRKKALTDYKKLRAFFVEEEEHFLQEAEKEEGLPEDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vinorelbine
AB0332 20 mg

Vinorelbine

Sign In for Pricing
View Details
Human Presepsin elisa kit
OM626435 96 Tests

Human Presepsin elisa kit

Sign In for Pricing
View Details
HSPC150/UBE2T Recombinant Antibody, Cy7 Conjugated
bsm-62809R-Cy7 100 µL

HSPC150/UBE2T Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
3- (2-Methyl-1,3-thiazol-4-yl) benzoic acid
DBA07741-01 2 g

3- (2-Methyl-1,3-thiazol-4-yl) benzoic acid

Sign In for Pricing
View Details
3- (2-Methyl-1,3-thiazol-4-yl) benzoic acid
DBA07741-02 5 g

3- (2-Methyl-1,3-thiazol-4-yl) benzoic acid

Sign In for Pricing
View Details
3- (2-Methyl-1,3-thiazol-4-yl) benzoic acid
DBA07741-03 10 g

3- (2-Methyl-1,3-thiazol-4-yl) benzoic acid

Sign In for Pricing
View Details