Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF187 Peptide - C-terminal region

RNF187 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RACO-1, RACO1

UniProt

Q5TA31

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RNF187 Rabbit Polyclonal Antibody (orb587740) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001010858

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ESAAAVWKGHVMDRRKKALTDYKKLRAFFVEEEEHFLQEAEKEEGLPEDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgG, Human (Biotin)
I1903-90W 1 mg

IgG, Human (Biotin)

Sign In for Pricing
View Details
Mouse Monoclonal Adenosine A2aR/A2bR Antibody (599743) [DyLight 350]
FAB94972D 0.1 mL

Mouse Monoclonal Adenosine A2aR/A2bR Antibody (599743) [DyLight 350]

Sign In for Pricing
View Details
IKIP Double Nickase Plasmid (h)
sc-409021-NIC 20 µg

IKIP Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Recombinant Mycobacterium Leprae nrdI Protein (aa 1-138) (strain Br4923)
VAng-Yyj2220-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Leprae nrdI Protein (aa 1-138) (strain Br4923)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Peroxisome Proliferator Activated Receptor Alpha (PPARa)
MBS2148468-01 0.1 mL

PE-Linked Polyclonal Antibody to Peroxisome Proliferator Activated Receptor Alpha (PPARa)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Peroxisome Proliferator Activated Receptor Alpha (PPARa)
MBS2148468-02 0.2 mL

PE-Linked Polyclonal Antibody to Peroxisome Proliferator Activated Receptor Alpha (PPARa)

Sign In for Pricing
View Details