DUX1 Peptide - middle region
DUX1 Peptide - middle region
Product Specifications
UniProt
O43812
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DUX1 Rabbit Polyclonal Antibody (orb587827) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_036278.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ACFERNPYPGIATRERLAQAIGIPEPRVQIWFQNERSRQLRQHRRESRPW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
H9244 96 Tests
Tubulin polymerization-promoting protein (TPPP) Human ELISA Kit
Sign In for Pricing
View Details 
orb3116356 100 µg
Calreticulin/CALR Rabbit Polyclonal Antibody (Fluoro647)
Sign In for Pricing
View Details