Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nfe2l1 Peptide - C-terminal region

Nfe2l1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AA408798, AW212678, LCR-F1, Lcrf1, NRF1, TCF-11, TCF11

UniProt

Q3V3M1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nfe2l1 Rabbit Polyclonal Antibody (orb573738) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032712

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVFGRLRDEHGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Monoclonal Antibody to Prostaglandin E1 (PGE1)
MBS2167318-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Prostaglandin E1 (PGE1)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Prostaglandin E1 (PGE1)
MBS2167318-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Prostaglandin E1 (PGE1)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Prostaglandin E1 (PGE1)
MBS2167318-03 0.5 mL

Biotin-Linked Monoclonal Antibody to Prostaglandin E1 (PGE1)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Prostaglandin E1 (PGE1)
MBS2167318-04 1 mL

Biotin-Linked Monoclonal Antibody to Prostaglandin E1 (PGE1)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Prostaglandin E1 (PGE1)
MBS2167318-05 5 mL

Biotin-Linked Monoclonal Antibody to Prostaglandin E1 (PGE1)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Prostaglandin E1 (PGE1)
MBS2167318-06 5x 5 mL

Biotin-Linked Monoclonal Antibody to Prostaglandin E1 (PGE1)

Sign In for Pricing
View Details