Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nfe2l1 Peptide - C-terminal region

Nfe2l1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AA408798, AW212678, LCR-F1, Lcrf1, NRF1, TCF-11, TCF11

UniProt

Q3V3M1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nfe2l1 Rabbit Polyclonal Antibody (orb573738) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032712

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVFGRLRDEHGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHYHIPL Recombinant Protein (Rat)
RP220415 100 µg

PHYHIPL Recombinant Protein (Rat)

Sign In for Pricing
View Details
Seasonal H1N1 Nucleocapsid Protein Antibody
24954 100 µL

Seasonal H1N1 Nucleocapsid Protein Antibody

Sign In for Pricing
View Details
4-Bromo-5-methyl-1H-indazole-3-carboxylic acid
OR1060894-01 100 mg

4-Bromo-5-methyl-1H-indazole-3-carboxylic acid

Sign In for Pricing
View Details
4-Bromo-5-methyl-1H-indazole-3-carboxylic acid
OR1060894-02 250 mg

4-Bromo-5-methyl-1H-indazole-3-carboxylic acid

Sign In for Pricing
View Details
4-Bromo-5-methyl-1H-indazole-3-carboxylic acid
OR1060894-03 1 g

4-Bromo-5-methyl-1H-indazole-3-carboxylic acid

Sign In for Pricing
View Details
Mug1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7516902 1.0 µg DNA

Mug1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details