Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubr7 Peptide - N-terminal region

Ubr7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RGD1359144

UniProt

Q642A8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ubr7 Rabbit Polyclonal Antibody (orb578843) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007706

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HGSHKLFELYTKRNFRCDCGNSKFKNLECKLFPDKSKVNSCNKYNDNFFG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDKN2AIP N-Terminal-Like Protein (CDKN2AIPNL) Antibody
abx109637-01 20 µg

CDKN2AIP N-Terminal-Like Protein (CDKN2AIPNL) Antibody

Sign In for Pricing
View Details
CDKN2AIP N-Terminal-Like Protein (CDKN2AIPNL) Antibody
abx109637-02 50 µg

CDKN2AIP N-Terminal-Like Protein (CDKN2AIPNL) Antibody

Sign In for Pricing
View Details
CDKN2AIP N-Terminal-Like Protein (CDKN2AIPNL) Antibody
abx109637-03 100 µg

CDKN2AIP N-Terminal-Like Protein (CDKN2AIPNL) Antibody

Sign In for Pricing
View Details
CDKN2AIP N-Terminal-Like Protein (CDKN2AIPNL) Antibody
abx109637-04 200 µg

CDKN2AIP N-Terminal-Like Protein (CDKN2AIPNL) Antibody

Sign In for Pricing
View Details
CDKN2AIP N-Terminal-Like Protein (CDKN2AIPNL) Antibody
abx109637-05 1 mg

CDKN2AIP N-Terminal-Like Protein (CDKN2AIPNL) Antibody

Sign In for Pricing
View Details
PPM1G Antibody
DF14057-01 100 µL

PPM1G Antibody

Sign In for Pricing
View Details