Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UFSP1 Peptide - C-terminal region

UFSP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

UFSP

UniProt

Q6NVU6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UFSP1 Rabbit Polyclonal Antibody (orb325918) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001015072

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DPHYWGTPKSPSELQAAGWVGWQEVSAAFDPNSFYNLCLTSLSSQQQQRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRDX2 Polyclonal Antibody
E-AB-12627-01 20 µL

PRDX2 Polyclonal Antibody

Sign In for Pricing
View Details
PRDX2 Polyclonal Antibody
E-AB-12627-02 60 µL

PRDX2 Polyclonal Antibody

Sign In for Pricing
View Details
PRDX2 Polyclonal Antibody
E-AB-12627-03 120 µL

PRDX2 Polyclonal Antibody

Sign In for Pricing
View Details
PRDX2 Polyclonal Antibody
E-AB-12627-04 200 µL

PRDX2 Polyclonal Antibody

Sign In for Pricing
View Details
Ccdc59 Mouse Gene Knockout Kit (CRISPR)
KN502726 1 Kit

Ccdc59 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant PF4 Antibody
RC-15634-01 50 μL

Recombinant PF4 Antibody

Sign In for Pricing
View Details