Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UFSP1 Peptide - C-terminal region

UFSP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

UFSP

UniProt

Q6NVU6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UFSP1 Rabbit Polyclonal Antibody (orb325918) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001015072

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DPHYWGTPKSPSELQAAGWVGWQEVSAAFDPNSFYNLCLTSLSSQQQQRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF312 (FEZF2) activation kit by CRISPRa
GA110498 1 Kit

Human ZNF312 (FEZF2) activation kit by CRISPRa

Sign In for Pricing
View Details
Human OR12D2 activation kit by CRISPRa
GA108894 1 Kit

Human OR12D2 activation kit by CRISPRa

Sign In for Pricing
View Details
Fibronectin (2755-8), CF640R conjugate, 0.1mg/mL
BNC400091-500 1x 500 µL

Fibronectin (2755-8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleolar / Nucleoli (NM95), CF647 conjugate, 0.1mg/mL
BNC470095-500 1x 500 µL

Nucleolar / Nucleoli (NM95), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Gab2 activation kit by CRISPRa
GA201511 1 Kit

Mouse Gab2 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Mouse CCL9/MIP-1-γ Protein
PKSM040984-01 10 µg

Recombinant Mouse CCL9/MIP-1-γ Protein

Sign In for Pricing
View Details