Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAMD10 Peptide - N-terminal region

SAMD10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C20orf136, dJ591C20, dJ591C20.7

UniProt

Q9BYL1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SAMD10 Rabbit Polyclonal Antibody (orb587743) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542188

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AHFSFCRTLLEHTVSAESIPCHLPRTPGTSLTWHDSRSQRAASSRPIKLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse IL17F Polyclonal Antibody
PMJ41201 100 μg

Anti-Mouse IL17F Polyclonal Antibody

Sign In for Pricing
View Details
FAM216A (Chromosome 12 Open Reading Frame 24, Protein FAM216A, C12orf24) (MaxLight 405) discontinued
126593-ML405 100 µL

FAM216A (Chromosome 12 Open Reading Frame 24, Protein FAM216A, C12orf24) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal FGF-13 Antibody (298923) [DyLight 680]
FAB1909Y 0.1 mL

Mouse Monoclonal FGF-13 Antibody (298923) [DyLight 680]

Sign In for Pricing
View Details
Keratin 4 Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-60219R-BF680 100 µL

Keratin 4 Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Variable charge X-linked protein 2 (VCX2) Human ELISA Kit
I1931 96 Tests

Variable charge X-linked protein 2 (VCX2) Human ELISA Kit

Sign In for Pricing
View Details
HTLV-1 Tax Polyclonal Antibody
orb3151219-01 50 µg

HTLV-1 Tax Polyclonal Antibody

Sign In for Pricing
View Details