Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAMD10 Peptide - N-terminal region

SAMD10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C20orf136, dJ591C20, dJ591C20.7

UniProt

Q9BYL1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SAMD10 Rabbit Polyclonal Antibody (orb587743) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_542188

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AHFSFCRTLLEHTVSAESIPCHLPRTPGTSLTWHDSRSQRAASSRPIKLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXO3A (Forkhead Box O3A, FKHLR1, FOXO3) (Biotin)
214845-Biotin 100 µL

FOXO3A (Forkhead Box O3A, FKHLR1, FOXO3) (Biotin)

Sign In for Pricing
View Details
Death Domain-Associated Protein 6 (DAXX) Antibody
abx112006 100 µL

Death Domain-Associated Protein 6 (DAXX) Antibody

Sign In for Pricing
View Details
Phospho-Na, K-ATPase α1 (Ser23) Antibody
CST 4006S 100 µL

Phospho-Na, K-ATPase α1 (Ser23) Antibody

Sign In for Pricing
View Details
NUSAP, NT (NUSAP1, ANKT, Nucleolar and spindle-associated protein 1) (MaxLight 405)
MBS6327331-01 0.1 mL

NUSAP, NT (NUSAP1, ANKT, Nucleolar and spindle-associated protein 1) (MaxLight 405)

Sign In for Pricing
View Details
NUSAP, NT (NUSAP1, ANKT, Nucleolar and spindle-associated protein 1) (MaxLight 405)
MBS6327331-02 5x 0.1 mL

NUSAP, NT (NUSAP1, ANKT, Nucleolar and spindle-associated protein 1) (MaxLight 405)

Sign In for Pricing
View Details
Sult3a1 Protein Vector (Mouse) (pPM-C-HA)
45861024 500 ng

Sult3a1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details