Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNH1 Peptide - N-terminal region

RNH1 Peptide - N-terminal region

Product Specifications

UniProt

P13489

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RNH1 Rabbit Polyclonal Antibody (orb587954) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_976323

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YCSLSAASCEPLASVLRAKPDFKELTVSNNDINEAGVRVLCQGLKDSPCQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 647 Anti-Mouse CD25 Antibody[PC-61.5.3]
E-AB-F1102M-01 50 Tests

Elab Fluor® 647 Anti-Mouse CD25 Antibody[PC-61.5.3]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD25 Antibody[PC-61.5.3]
E-AB-F1102M-02 100 Tests

Elab Fluor® 647 Anti-Mouse CD25 Antibody[PC-61.5.3]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD25 Antibody[PC-61.5.3]
E-AB-F1102M-03 2x 100 Tests

Elab Fluor® 647 Anti-Mouse CD25 Antibody[PC-61.5.3]

Sign In for Pricing
View Details
Itga4 Rat Monoclonal Antibody [Clone ID: R1-2]
CL030B 100 µg

Itga4 Rat Monoclonal Antibody [Clone ID: R1-2]

Sign In for Pricing
View Details
Rho guanine exchange factor 15 (ARHGEF15) (NM_173728) Human Recombinant Protein
TP307435M 100 µg

Rho guanine exchange factor 15 (ARHGEF15) (NM_173728) Human Recombinant Protein

Sign In for Pricing
View Details
CD79a (HM47/A9), CF405S conjugate, 0.1mg/mL
BNC040477-500 1x 500 µL

CD79a (HM47/A9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details