RNH1 Peptide - N-terminal region
RNH1 Peptide - N-terminal region
Product Specifications
UniProt
P13489
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RNH1 Rabbit Polyclonal Antibody (orb587954) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_976323
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YCSLSAASCEPLASVLRAKPDFKELTVSNNDINEAGVRVLCQGLKDSPCQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682563-100 1x 100 µL
GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2563), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880091-500 1x 500 µL
Fibronectin (2755-8), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
