Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF138 Peptide - middle region

ZNF138 Peptide - middle region

Product Specifications

UniProt

P52744

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF138 Rabbit Polyclonal Antibody (orb580113) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKAFKQSSHLTRHKIIHTEEKPYKCEQCGKVFKQSPTLTKHQIIYTGEEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scamp2 3'UTR Luciferase Stable Cell Line
TU118380 1.0 mL

Scamp2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rat Collagen Type III (COL3) Wide-range ELISA Kit
EKN51641 96 Tests

Rat Collagen Type III (COL3) Wide-range ELISA Kit

Sign In for Pricing
View Details
WDR24 shRNA Plasmid (m)
sc-155268-SH 20 µg

WDR24 shRNA Plasmid (m)

Sign In for Pricing
View Details
Human BTG1 Knockout HEK293T cell line
GTR15409523 1 Vial

Human BTG1 Knockout HEK293T cell line

Sign In for Pricing
View Details
6PPD-Quinone methyl ester-d5
HY-W754406 1 Each

6PPD-Quinone methyl ester-d5

Sign In for Pricing
View Details
HDHD3 Antibody, Biotin conjugated
CSB-PA883592LD01HU-01 50 µg

HDHD3 Antibody, Biotin conjugated

Sign In for Pricing
View Details