Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF138 Peptide - middle region

ZNF138 Peptide - middle region

Product Specifications

UniProt

P52744

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF138 Rabbit Polyclonal Antibody (orb580113) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKAFKQSSHLTRHKIIHTEEKPYKCEQCGKVFKQSPTLTKHQIIYTGEEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human OTUB1
P6417-01 50 µg

Recombinant Human OTUB1

Sign In for Pricing
View Details
Recombinant Human OTUB1
P6417-02 200 µg

Recombinant Human OTUB1

Sign In for Pricing
View Details
Recombinant Human OTUB1
P6417-03 1 mg

Recombinant Human OTUB1

Sign In for Pricing
View Details
Bardet-Biedl Syndrome 10 Protein (BBS10) Antibody
abx036653-01 100 µg

Bardet-Biedl Syndrome 10 Protein (BBS10) Antibody

Sign In for Pricing
View Details
Bardet-Biedl Syndrome 10 Protein (BBS10) Antibody
abx036653-02 1 mg

Bardet-Biedl Syndrome 10 Protein (BBS10) Antibody

Sign In for Pricing
View Details
Anti-Neurocan/NCAN Antibody Picoband
MBS1755545-01 0.01 mg

Anti-Neurocan/NCAN Antibody Picoband

Sign In for Pricing
View Details