Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IDH3B Peptide - N-terminal region

IDH3B Peptide - N-terminal region

Product Specifications

UniProt

O43837

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IDH3B Rabbit Polyclonal Antibody (orb586548) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pExpress-1-Tut1 Plasmid
PVT44946 2 µg

pExpress-1-Tut1 Plasmid

Sign In for Pricing
View Details
Trim28 Rat shRNA Plasmid (Locus ID 116698)
TL712256 1 Kit

Trim28 Rat shRNA Plasmid (Locus ID 116698)

Sign In for Pricing
View Details
Interleukin-17B, active (IL17B), Recombinant, Human
348112 5 µg

Interleukin-17B, active (IL17B), Recombinant, Human

Sign In for Pricing
View Details
TPTE2 (NM_001141968) Human Tagged ORF Clone Lentiviral Particle
RC227282L4V 200 µL

TPTE2 (NM_001141968) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Reelin (RELN) Rat ELISA Kit
G6949 96 Tests

Reelin (RELN) Rat ELISA Kit

Sign In for Pricing
View Details
Galr3 Mouse siRNA Oligo Duplex (Locus ID 14429)
SR412477 1 Kit

Galr3 Mouse siRNA Oligo Duplex (Locus ID 14429)

Sign In for Pricing
View Details