ZNF254 Peptide - middle region
ZNF254 Peptide - middle region
Product Specifications
UniProt
O75437
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF254 Rabbit Polyclonal Antibody (orb327181) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: WSSTLTNHRKIYTEEKPYKCEEYNKSPKQLSTLTTHEIIHAGEKLYKCEE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K4495707 1.0 µg DNA
Kctd6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details 
TRV-0031052 96 Tests
Multiplex Assay Kit for Cereblon (CRBN), etc. by FLIA (Flow Luminescence Immunoassay)
Sign In for Pricing
View Details K1021606 1.0 µg DNA
IFNP23 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
Sign In for Pricing
View Details