Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF254 Peptide - middle region

ZNF254 Peptide - middle region

Product Specifications

UniProt

O75437

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF254 Rabbit Polyclonal Antibody (orb327181) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WSSTLTNHRKIYTEEKPYKCEEYNKSPKQLSTLTTHEIIHAGEKLYKCEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Conjugated VEGF Rabbit mAb
C58580 100 µL

Conjugated VEGF Rabbit mAb

Sign In for Pricing
View Details
Gallopamil hydrochloride
T11353L-01 1 mg

Gallopamil hydrochloride

Sign In for Pricing
View Details
Gallopamil hydrochloride
T11353L-02 5 mg

Gallopamil hydrochloride

Sign In for Pricing
View Details
Gallopamil hydrochloride
T11353L-03 1 mL - 10 mM (in DMSO)

Gallopamil hydrochloride

Sign In for Pricing
View Details
Gallopamil hydrochloride
T11353L-04 10 mg

Gallopamil hydrochloride

Sign In for Pricing
View Details
Gallopamil hydrochloride
T11353L-05 25 mg

Gallopamil hydrochloride

Sign In for Pricing
View Details