Rb1 Peptide - middle region
Rb1 Peptide - middle region
Product Specifications
Product Name Alternative
Rb, Rb-1, pRb
UniProt
P13405
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Rb1 Rabbit Polyclonal Antibody (orb574558) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_033055
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TETQAASAFHTQKPLKSTSLALFYKKVYRLAYLRLNTLCARLLSDHPELE
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9361844-01 48 Well
Rat General Transcription Factor II A, 1-Like Factor (GTF2A1L) ELISA Kit
Sign In for Pricing
View Details 
MBS9361844-02 96 Well
Rat General Transcription Factor II A, 1-Like Factor (GTF2A1L) ELISA Kit
Sign In for Pricing
View Details 
MBS9361844-03 5x 96 Well
Rat General Transcription Factor II A, 1-Like Factor (GTF2A1L) ELISA Kit
Sign In for Pricing
View Details MBS9361844-04 10x 96 Well
Rat General Transcription Factor II A, 1-Like Factor (GTF2A1L) ELISA Kit
Sign In for Pricing
View Details