Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rb1 Peptide - middle region

Rb1 Peptide - middle region

Product Specifications

Product Name Alternative

Rb, Rb-1, pRb

UniProt

P13405

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rb1 Rabbit Polyclonal Antibody (orb574558) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033055

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TETQAASAFHTQKPLKSTSLALFYKKVYRLAYLRLNTLCARLLSDHPELE

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINA1 Polyclonal Antibody, Biotin Conjugated
A64155-100 100 µL

SERPINA1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Ube2f Mouse siRNA Oligo Duplex (Locus ID 67921)
SR404539 1 Kit

Ube2f Mouse siRNA Oligo Duplex (Locus ID 67921)

Sign In for Pricing
View Details
Enkephalin-met, acetaldehyde-
T31632-01 100 mg

Enkephalin-met, acetaldehyde-

Sign In for Pricing
View Details
Enkephalin-met, acetaldehyde-
T31632-02 500 mg

Enkephalin-met, acetaldehyde-

Sign In for Pricing
View Details
CCNA2 Adenovirus (Mouse)
15381054 1.0 mL

CCNA2 Adenovirus (Mouse)

Sign In for Pricing
View Details
Rat Myo15a Pre-designed siRNA Set A
SI208931A 1 Each

Rat Myo15a Pre-designed siRNA Set A

Sign In for Pricing
View Details