Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC11A1 Peptide - middle region

SLC11A1 Peptide - middle region

Product Specifications

Product Name Alternative

LSH, NRAMP, NRAMP1

UniProt

P49279

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC11A1 Rabbit Polyclonal Antibody (orb578919) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000569

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GYEYVVARPEQGALLRGLFLPSCPGCGHPELLQAVGIVGAIIMPHNIYLH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD14 Mouse Monoclonal Antibody [Clone ID: OTI10C2]
CF811289 100 µg

CD14 Mouse Monoclonal Antibody [Clone ID: OTI10C2]

Sign In for Pricing
View Details
N-(2-Hydroxyethyl)-D-glucamine
TRC-H942225-10MG 10 mg

N-(2-Hydroxyethyl)-D-glucamine

Sign In for Pricing
View Details
Apg10 (ATG10) Rabbit Polyclonal Antibody
TA392683 100 µL

Apg10 (ATG10) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mono[2-(perfluorooctyl)ethyl] phosphate
TRC-M566820-10MG 10 mg

Mono[2-(perfluorooctyl)ethyl] phosphate

Sign In for Pricing
View Details
Protein G agarose gel
EA-IP-016 2 mL

Protein G agarose gel

Sign In for Pricing
View Details
Plakophilin 1 (PKP1) (NM_001005337) Human Recombinant Protein
TP316972M 100 µg

Plakophilin 1 (PKP1) (NM_001005337) Human Recombinant Protein

Sign In for Pricing
View Details