Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNC1LI2 Peptide - N-terminal region

DYNC1LI2 Peptide - N-terminal region

Product Specifications

UniProt

B4DZP4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DYNC1LI2 Rabbit Polyclonal Antibody (orb586542) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KLPSGKNILVFGEDGSGKTTLMTKLQGAEHGKKGRGLEYLYLSVHDEDRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPPP Rabbit Polyclonal Antibody (HRP)
orb2095988 100 µL

TPPP Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
PRSS2 Rabbit Polyclonal Antibody (HRP)
orb478230 100 µL

PRSS2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Phospho-MST1 (Thr183) Rabbit Polyclonal Antibody (Cy3)
orb989562 100 µL

Phospho-MST1 (Thr183) Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Recombinant Shewanella pealeana Argininosuccinate synthase (argG)
MBS1223634-01 0.02 mg (E-Coli)

Recombinant Shewanella pealeana Argininosuccinate synthase (argG)

Sign In for Pricing
View Details
Recombinant Shewanella pealeana Argininosuccinate synthase (argG)
MBS1223634-02 0.02 mg (Yeast)

Recombinant Shewanella pealeana Argininosuccinate synthase (argG)

Sign In for Pricing
View Details
Recombinant Shewanella pealeana Argininosuccinate synthase (argG)
MBS1223634-03 0.1 mg (E-Coli)

Recombinant Shewanella pealeana Argininosuccinate synthase (argG)

Sign In for Pricing
View Details