Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10A2 Peptide - C-terminal region

OR10A2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR10A2P, OR11-82, OR11-86, OST363

UniProt

Q9H208

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR10A2 Rabbit Polyclonal Antibody (orb327061) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004460

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SHLLVVSLFYISLSLTYFRPKSNNSPEGKKLLSLSYTVMTPMLNPIIYSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHF6 Antibody
A45805-50UL 50 μL

PHF6 Antibody

Sign In for Pricing
View Details
ITPK1 Lentiviral Activation Particles (h2)
sc-409464-LAC-2 200 µL

ITPK1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Cytokeratin 13 (ABT-CK13) Antibody
V0045-01 20 µL

Cytokeratin 13 (ABT-CK13) Antibody

Sign In for Pricing
View Details
Cytokeratin 13 (ABT-CK13) Antibody
V0045-02 50 μL

Cytokeratin 13 (ABT-CK13) Antibody

Sign In for Pricing
View Details
Cytokeratin 13 (ABT-CK13) Antibody
V0045-03 100 µL

Cytokeratin 13 (ABT-CK13) Antibody

Sign In for Pricing
View Details
Cytokeratin 13 (ABT-CK13) Antibody
V0045-04 200 µL

Cytokeratin 13 (ABT-CK13) Antibody

Sign In for Pricing
View Details