OR10A2 Peptide - C-terminal region
OR10A2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR10A2P, OR11-82, OR11-86, OST363
UniProt
Q9H208
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR10A2 Rabbit Polyclonal Antibody (orb327061) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001004460
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SHLLVVSLFYISLSLTYFRPKSNNSPEGKKLLSLSYTVMTPMLNPIIYSL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal OBFC2B Antibody (OTI1E11) [Alexa Fluor 700]](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
NBP2-73140AF700 0.1 mL
Mouse Monoclonal OBFC2B Antibody (OTI1E11) [Alexa Fluor 700]
Sign In for Pricing
View Details 
ARP59957_P050-FITC 100 µL
ADORA3 Antibody - C-terminal region : FITC (ARP59957_P050-FITC)
Sign In for Pricing
View Details MBS1153097-01 0.02 mg (E-Coli)
Recombinant Cupriavidus necator Metapyrocatechase 2 (mcpII)
Sign In for Pricing
View Details MBS1153097-02 0.02 mg (Yeast)
Recombinant Cupriavidus necator Metapyrocatechase 2 (mcpII)
Sign In for Pricing
View Details MBS1153097-03 0.1 mg (E-Coli)
Recombinant Cupriavidus necator Metapyrocatechase 2 (mcpII)
Sign In for Pricing
View Details