Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIAL4G Peptide - C-terminal region

PPIAL4G Peptide - C-terminal region

Product Specifications

Product Name Alternative

BX284650.5

UniProt

A2BFH1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPIAL4G Rabbit Polyclonal Antibody (orb327082) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001116540

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NGSQFFICTAKTEWLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HYAL4 3'UTR GFP Stable Cell Line
TU060355 1.0 mL

HYAL4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
HCM (RNMT) (NM_003799) Human Recombinant Protein
PROTO43148 20 µg

HCM (RNMT) (NM_003799) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant ASFV Ken-153 Protein (aa 17-239)
VAng-2121Lsx-500g 500 µg

Recombinant ASFV Ken-153 Protein (aa 17-239)

Sign In for Pricing
View Details
MIR140 ORF Vector (Human) (pORF)
ORF023732 1.0 µg DNA

MIR140 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
MFSD7 Protein Vector (Human) (pPM-C-HA)
PV025711 500 ng

MFSD7 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-SERPINE1/PAI-1 (MEDI-579) Biosimilar (Monoclonal, IgG1-kappa)
A136568 100 µL

Anti-SERPINE1/PAI-1 (MEDI-579) Biosimilar (Monoclonal, IgG1-kappa)

Sign In for Pricing
View Details