Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIAL4G Peptide - C-terminal region

PPIAL4G Peptide - C-terminal region

Product Specifications

Product Name Alternative

BX284650.5

UniProt

A2BFH1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPIAL4G Rabbit Polyclonal Antibody (orb327082) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001116540

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NGSQFFICTAKTEWLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sterile α and TIR motif-containing protein 1 (SARM1) Human ELISA Kit
H3214 96 Tests

Sterile α and TIR motif-containing protein 1 (SARM1) Human ELISA Kit

Sign In for Pricing
View Details
Tnfrsf1b (NM_011610) Mouse Tagged ORF Clone
MR226216 10 µg

Tnfrsf1b (NM_011610) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Sh2b3-set siRNA/shRNA/RNAi Lentivector (Rat)
43649096 4x 500 ng

Sh2b3-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Rp-8-Br-PET-cGMPS
BLG-P007-01 1 μmoL

Rp-8-Br-PET-cGMPS

Sign In for Pricing
View Details
IL-13 ELISpot Assay Kit (Human)
OKDB00021-5X96W 5x 96 Well

IL-13 ELISpot Assay Kit (Human)

Sign In for Pricing
View Details
Mouse Monoclonal Pancreatic Amylase Beta Antibody (OTI4B5) [DyLight 550]
NBP2-73240R 0.1 mL

Mouse Monoclonal Pancreatic Amylase Beta Antibody (OTI4B5) [DyLight 550]

Sign In for Pricing
View Details