EXOC2 Peptide - N-terminal region
EXOC2 Peptide - N-terminal region
Product Specifications
UniProt
G8JLK9
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EXOC2 Rabbit Polyclonal Antibody (orb587974) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MLDLDNDTRPSVLGHLSQTASLKRGSSFQSGRDDTWRYKTPHRVAFVEKL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040737-100 1x 100 µL
MART-1 / Melan-A / MLANA (Melanoma Marker) (DT101 + BC199), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUB2615-100 1x 100 µL
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2615), 0.2mg/mL
Sign In for Pricing
View Details 