EXOC2 Peptide - N-terminal region
EXOC2 Peptide - N-terminal region
Product Specifications
UniProt
G8JLK9
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EXOC2 Rabbit Polyclonal Antibody (orb587974) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MLDLDNDTRPSVLGHLSQTASLKRGSSFQSGRDDTWRYKTPHRVAFVEKL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSV030433 100 µg
Recombinant SARS-CoV-2 Spike RBD (A344S) (His Tag)
Sign In for Pricing
View Details 
NUN-C52Hn-1mg 1 mg
SARS-CoV-2 Nucleocapsid protein (R203M, D377Y), His Tag
Sign In for Pricing
View Details 