Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK17B Peptide - C-terminal region

STK17B Peptide - C-terminal region

Product Specifications

Product Name Alternative

DRAK2

UniProt

Q53QE7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004217

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMVSKRFRFDDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ki67 (MKI67) Mouse Monoclonal Antibody [Clone ID: 9C12B2]
AM06395SU-N 100 µL

Ki67 (MKI67) Mouse Monoclonal Antibody [Clone ID: 9C12B2]

Sign In for Pricing
View Details
PAX6 (PAX6/1166), CF647 conjugate, 0.1mg/mL
BNC471166-500 1x 500 µL

PAX6 (PAX6/1166), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse M-CSF
6534 5 µg

Recombinant Mouse M-CSF

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/835), CF647 conjugate, 0.1mg/mL
BNC470835-100 1x 100 µL

Cytokeratin 18 (KRT18/835), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PHB Rabbit Monoclonal Antibody [Clone ID: 24GB6045]
TA425145 100 µL

PHB Rabbit Monoclonal Antibody [Clone ID: 24GB6045]

Sign In for Pricing
View Details
SGPL1 (NM_003901) Human Recombinant Protein
TP308705L 1 mg

SGPL1 (NM_003901) Human Recombinant Protein

Sign In for Pricing
View Details