Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK17B Peptide - C-terminal region

STK17B Peptide - C-terminal region

Product Specifications

Product Name Alternative

DRAK2

UniProt

Q53QE7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004217

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMVSKRFRFDDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p95 NBS1 (NBN) (NM_002485) Human Over-expression Lysate
LC419300 20 µg

p95 NBS1 (NBN) (NM_002485) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CXADR Recombinant Rabbit monoclonal Antibody
HA725293 100 µL

Human CXADR Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Growth Arrest Specific Protein 7 (GAS7) Human qPCR Primer Pair (NM_201433)
HP230099 200 Reactions

Growth Arrest Specific Protein 7 (GAS7) Human qPCR Primer Pair (NM_201433)

Sign In for Pricing
View Details
1-t-Boc-piperidine-4-spiro-5’-[1’,3’-bis-t-boc]hydantoin
TRC-B663125-250MG 250 mg

1-t-Boc-piperidine-4-spiro-5’-[1’,3’-bis-t-boc]hydantoin

Sign In for Pricing
View Details
PI 3 Kinase Class 2A (PIK3C2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C11]
TA801725AM 100 µL

PI 3 Kinase Class 2A (PIK3C2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C11]

Sign In for Pricing
View Details
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), CF640R conjugate, 0.1mg/mL
BNC402206-500 1x 500 µL

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details