OR5B3 Peptide - C-terminal region
OR5B3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR11-239, OR5B13, OST129
UniProt
Q8NH48
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR5B3 Rabbit Polyclonal Antibody (orb587610) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005469
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SSSHSMDTDKMAPVFYTMVIPMLNPLVYSLRNKEVKSAFKKVVEKAKLSV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSH033502-01 10 µg
Recombinant Human FGF-2/FGF basic/FGFb Protein (aa 1-155) (Q65I, C96S, N111G)
Sign In for Pricing
View Details PKSH033502-02 50 µg
Recombinant Human FGF-2/FGF basic/FGFb Protein (aa 1-155) (Q65I, C96S, N111G)
Sign In for Pricing
View Details 
orb2973765-01 50 Tests
CD183/CXCR3 Mouse Monoclonal Antibody (FITC)
Sign In for Pricing
View Details orb2973765-02 100 Tests
CD183/CXCR3 Mouse Monoclonal Antibody (FITC)
Sign In for Pricing
View Details