Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STRN3 Peptide - C-terminal region

STRN3 Peptide - C-terminal region

Product Specifications

UniProt

G3V340

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STRN3 Rabbit Polyclonal Antibody (orb331418) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HKIGNEGLAADLTDDPDTEEALKEFDFLVTAEDGEGAGEARSSGDGTEWV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LPCAT1 (NM_024830) Human Over-expression Lysate
LC403037 20 µg

LPCAT1 (NM_024830) Human Over-expression Lysate

Sign In for Pricing
View Details
5alpha-Androstane-2beta,3alpha-diol-17-one
TRC-D949090-50MG 50 mg

5alpha-Androstane-2beta,3alpha-diol-17-one

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD39 Antibody[A1]
E-AB-F1165M-01 20 Tests

Elab Fluor® 647 Anti-Human CD39 Antibody[A1]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD39 Antibody[A1]
E-AB-F1165M-02 100 Tests

Elab Fluor® 647 Anti-Human CD39 Antibody[A1]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD39 Antibody[A1]
E-AB-F1165M-03 2x 100 Tests

Elab Fluor® 647 Anti-Human CD39 Antibody[A1]

Sign In for Pricing
View Details
AVPR1B Antibody
8G787-AAT 50 µg

AVPR1B Antibody

Sign In for Pricing
View Details