STRN3 Peptide - C-terminal region
STRN3 Peptide - C-terminal region
Product Specifications
UniProt
G3V340
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with STRN3 Rabbit Polyclonal Antibody (orb331418) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HKIGNEGLAADLTDDPDTEEALKEFDFLVTAEDGEGAGEARSSGDGTEWV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PD1 (PDCD1) Mouse Monoclonal Antibody [Clone ID: OTI24D2]](https://cdn.genprice.uk/products/937/68dd18b9061270361e908229/imageurl/cf808036.webp)
CF808036 100 µg
PD1 (PDCD1) Mouse Monoclonal Antibody [Clone ID: OTI24D2]
Sign In for Pricing
View Details 
BNC680950-500 1x 500 µL
MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![PE/Cyanine5 Anti-Mouse CD40 Antibody[FGK4.5/FGK45]](https://cdn.genprice.uk/products/763/68dd14af061270361e7d379f/imageurl/e-ab-f1028g.webp)
E-AB-F1028G-01 50 Tests
PE/Cyanine5 Anti-Mouse CD40 Antibody[FGK4.5/FGK45]
Sign In for Pricing
View Details E-AB-F1028G-02 100 Tests
PE/Cyanine5 Anti-Mouse CD40 Antibody[FGK4.5/FGK45]
Sign In for Pricing
View Details