Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFAP74 Peptide - C-terminal region

CFAP74 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C1orf222, KIAA1751

UniProt

Q9C0B2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CFAP74 Rabbit Polyclonal Antibody (orb587492) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AATSFSEQQLEGTESSQADMQSRKELEKLDKEQEEEQPAGEPGCQAKPGW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human RLN2 shRNA (UAS) - Lentiviral human RLN2 shRNA (UAS, GFP) (100)
GTR15331584 1 Vial

Lentiviral human RLN2 shRNA (UAS) - Lentiviral human RLN2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Tgfb2 3'UTR Luciferase Stable Cell Line
TU120412 1.0 mL

Tgfb2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Guinea Pig PDGF receptor ELISA Kit
GTR10317760 96 Well

Guinea Pig PDGF receptor ELISA Kit

Sign In for Pricing
View Details
POU2F1 Protein Vector (Mouse) (pPB-N-His)
PV218075 500 ng

POU2F1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
IRX4 (Biotin)
565904-01 50 µg

IRX4 (Biotin)

Sign In for Pricing
View Details
IRX4 (Biotin)
565904-02 100 µg

IRX4 (Biotin)

Sign In for Pricing
View Details