Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFAP74 Peptide - C-terminal region

CFAP74 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C1orf222, KIAA1751

UniProt

Q9C0B2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CFAP74 Rabbit Polyclonal Antibody (orb587492) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AATSFSEQQLEGTESSQADMQSRKELEKLDKEQEEEQPAGEPGCQAKPGW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Galectin-3 antigen
MBS170654-01 1 mg

Galectin-3 antigen

Sign In for Pricing
View Details
Galectin-3 antigen
MBS170654-02 5x 1 mg

Galectin-3 antigen

Sign In for Pricing
View Details
Human PXR knockout cell line
ABC-KH17946 1 Vial

Human PXR knockout cell line

Sign In for Pricing
View Details
UCHL5 Conjugated Antibody
orb1621859 100 µL

UCHL5 Conjugated Antibody

Sign In for Pricing
View Details
IL13RA1 discontinued
390431 200 µL

IL13RA1 discontinued

Sign In for Pricing
View Details
Anti-VEGFB
A2303-1mg*25 25x 1 mg

Anti-VEGFB

Sign In for Pricing
View Details