Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR78 Peptide - N-terminal region

WDR78 Peptide - N-terminal region

Product Specifications

Product Name Alternative

WDR78

UniProt

Q5VTH9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR78 Rabbit Polyclonal Antibody (orb587799) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VMVSVESEEAEKVTQRNKNYEVLCRNRLGNDLYVERMMQTFNGAPKNKDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human A Kinase Anchor Protein 1 (AKAP1)
RPU58003-01 50 µg

Recombinant Human A Kinase Anchor Protein 1 (AKAP1)

Sign In for Pricing
View Details
Recombinant Human A Kinase Anchor Protein 1 (AKAP1)
RPU58003-02 100 µg

Recombinant Human A Kinase Anchor Protein 1 (AKAP1)

Sign In for Pricing
View Details
Recombinant Human A Kinase Anchor Protein 1 (AKAP1)
RPU58003-03 1 mg

Recombinant Human A Kinase Anchor Protein 1 (AKAP1)

Sign In for Pricing
View Details
Anti-Scavenging Receptor SR-BI/SCARB1 Antibody Picoband® Fluoro488 Conjugated
A01093-1-Fluoro488 100 µg/Vial

Anti-Scavenging Receptor SR-BI/SCARB1 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Apoc3 AAV siRNA Pooled Vector
12179164 1.0 µg

Apoc3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
CD1d Rabbit Polyclonal Antibody (BF555)
orb1575994 100 µL

CD1d Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details