Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR78 Peptide - N-terminal region

WDR78 Peptide - N-terminal region

Product Specifications

Product Name Alternative

WDR78

UniProt

Q5VTH9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR78 Rabbit Polyclonal Antibody (orb587799) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VMVSVESEEAEKVTQRNKNYEVLCRNRLGNDLYVERMMQTFNGAPKNKDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interiotherin C
380497 5 mg

Interiotherin C

Sign In for Pricing
View Details
SLC6A20 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2162305 3x 1.0 µg

SLC6A20 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Sts1 (UBASH3B) Rabbit Polyclonal Antibody
TA342610 100 µL

Sts1 (UBASH3B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human C-Terminal Fragment of Agrin (CAF) ELISA Kit
201-12-8109 96 Tests

Human C-Terminal Fragment of Agrin (CAF) ELISA Kit

Sign In for Pricing
View Details
Mouse Ovarian Endometrial Cells
RPC-459 5x 10^5

Mouse Ovarian Endometrial Cells

Sign In for Pricing
View Details
Hdgf sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4641405 3x 1.0 µg

Hdgf sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details