CENPK Peptide - N-terminal region
CENPK Peptide - N-terminal region
Product Specifications
Product Name Alternative
CENPK
UniProt
D6RHD3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CENPK Rabbit Polyclonal Antibody (orb586533) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EMVLSTKESKNEKLKEDLEREQRWLDEQQQIMESLNVLHSELKNKVETFS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-A610660-50MG 50 mg
3-(4-Amino-3,5-dibromophenoxy)-2,4,6-tribromobenzenamine
Sign In for Pricing
View Details 
RDR-TNFb-Rb-01 96 Tests
Rabbit Tumor Necrosis Factor Beta (TNFb) ELISA Kit
Sign In for Pricing
View Details RDR-TNFb-Rb-02 48 Tests
Rabbit Tumor Necrosis Factor Beta (TNFb) ELISA Kit
Sign In for Pricing
View Details ![NM23A (NME1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7F6]](https://cdn.genprice.uk/products/937/6868c39f994c49e6dc3fb0e6/imageurl/ta801261bm.webp)
TA801261BM 100 µL
NM23A (NME1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7F6]
Sign In for Pricing
View Details