Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WWC3 Peptide - N-terminal region

WWC3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

WWC3, KIAA1280

UniProt

Q9ULE0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WWC3 Rabbit Polyclonal Antibody (orb587802) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YLIVAQEALNAKKEIYQIKQQRFELAQEEYQQLHKMCEDDSRSYASSFSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ICAM1 Antibody Picoband®, Cy3 Conjugate
PB9017-Cy3 100 µg/Vial

Anti-ICAM1 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Human SLC25A38 shRNA Plasmid
abx960374-01 150 µg

Human SLC25A38 shRNA Plasmid

Sign In for Pricing
View Details
Human SLC25A38 shRNA Plasmid
abx960374-02 300 µg

Human SLC25A38 shRNA Plasmid

Sign In for Pricing
View Details
FGA (Fibrinogen alpha Chain) (MaxLight 405) discontinued
126757-ML405 100 µL

FGA (Fibrinogen alpha Chain) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Polyclonal CGI-143 antibody - N-terminal region
APR00654G 0.05mg

Polyclonal CGI-143 antibody - N-terminal region

Sign In for Pricing
View Details
NDST4 antibody - N-terminal region
MBS3209600-01 0.1 mL

NDST4 antibody - N-terminal region

Sign In for Pricing
View Details