WWC3 Peptide - N-terminal region
WWC3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
WWC3, KIAA1280
UniProt
Q9ULE0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with WWC3 Rabbit Polyclonal Antibody (orb587802) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YLIVAQEALNAKKEIYQIKQQRFELAQEEYQQLHKMCEDDSRSYASSFSG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Phospho-Huntingtin (Ser421)[Ser419] Antibody](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
20120007-3 5 mL
Lens culinaris Lectin (LCA/LCH) - Separopore® 4B
Sign In for Pricing
View Details 
C0014 00500 500 mL
Conductivity Standard 400 Microsiemense/Cm (μs/cm) Traceable To NIST
Sign In for Pricing
View Details