Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRN3 Peptide - C-terminal region

LRRN3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LRRN3, Nbla10363, UNQ194/PRO220

UniProt

Q9H3W5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRN3 Rabbit Polyclonal Antibody (orb587876) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060804

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KNRKKCVNVTTKGLHPDQKEYEKNNTTTLMACLGGLLGIIGVICLISCLS

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti- Human Full length Polyclonal Antibody
E53P07562 100 µL

Anti- Human Full length Polyclonal Antibody

Sign In for Pricing
View Details
2LSZH-094-2-YL-2 AB Labels
140966 Roll of 5000 Piece(s)

2LSZH-094-2-YL-2 AB Labels

Sign In for Pricing
View Details
Nalidixic acid
sc-219324 5 g

Nalidixic acid

Sign In for Pricing
View Details
Recombinant Escherichia coli Protein psiE (psiE), partial
MBS7071570 Inquire

Recombinant Escherichia coli Protein psiE (psiE), partial

Sign In for Pricing
View Details
Cyp26b1 Antibody
orb859273 2 mg

Cyp26b1 Antibody

Sign In for Pricing
View Details
COPZ2 Rabbit Polyclonal Antibody (BF750)
orb2519319 100 µL

COPZ2 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details