LRRN3 Peptide - C-terminal region
LRRN3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
LRRN3, Nbla10363, UNQ194/PRO220
UniProt
Q9H3W5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LRRN3 Rabbit Polyclonal Antibody (orb587876) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060804
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KNRKKCVNVTTKGLHPDQKEYEKNNTTTLMACLGGLLGIIGVICLISCLS
More Discoveries
Explore Other Products
Browse additional items from our catalog
K6897507 1.0 µg DNA
Csrp2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
Sign In for Pricing
View Details 
039788-Biotin 200 µL
PDCD2L, ID (PDCD2L, Programmed cell death protein 2-like) (Biotin) discontinued
Sign In for Pricing
View Details E45H30786E1 50 µg
Lefty (LEFTY1) (NM_020997) Human Recombinant Protein
Sign In for Pricing
View Details