Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK10 Peptide - C-terminal region

CDK10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CDK10

UniProt

Q15131

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDK10 Rabbit Polyclonal Antibody (orb587956) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGTPSENIWPGFSKLPLVGQYSLRKQPYNNLKHKFPWLSEAGLRLLHFLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Progesterone Receptor Antibody
KC-1819-01 50 μL

Progesterone Receptor Antibody

Sign In for Pricing
View Details
Progesterone Receptor Antibody
KC-1819-02 100 µL

Progesterone Receptor Antibody

Sign In for Pricing
View Details
Progesterone Receptor Antibody
KC-1819-03 1 mL

Progesterone Receptor Antibody

Sign In for Pricing
View Details
RASSF1 Rabbit Monoclonal Antibody
TA423194 100 µL

RASSF1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Perfluoroundecanoic Acid
TRC-P286495-5G 5 g

Perfluoroundecanoic Acid

Sign In for Pricing
View Details
Ube2o Mouse Gene Knockout Kit (CRISPR)
KN518585 1 Kit

Ube2o Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details