CDK10 Peptide - C-terminal region
CDK10 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CDK10
UniProt
Q15131
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CDK10 Rabbit Polyclonal Antibody (orb587956) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LGTPSENIWPGFSKLPLVGQYSLRKQPYNNLKHKFPWLSEAGLRLLHFLF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB3325-100 1x 100 µL
Histone H1 (Pan Nuclear Marker) (AE-4), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![TUBAL3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C5]](https://cdn.genprice.uk/products/937/68dd1b6d061270361ea16e35/imageurl/ta503909bm.webp)
TA503909BM 100 µL
TUBAL3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C5]
Sign In for Pricing
View Details ![PSIP1 Recombinant Rabbit Monoclonal Antibody [PSH02-55]](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea81650/imageurl/ha721831.webp)
HA721831 100 µL
PSIP1 Recombinant Rabbit Monoclonal Antibody [PSH02-55]
Sign In for Pricing
View Details 
