What is the catalog number for KLHDC10 Peptide - C-terminal region?

The catalog number for KLHDC10 Peptide - C-terminal region is orb2003134.

What sizes are available for KLHDC10 Peptide - C-terminal region?

KLHDC10 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is KLHDC10 Peptide - C-terminal region in stock?

KLHDC10 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

KLHDC10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KLHDC10, KIAA0265

UniProt

Q6PID8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YSTDLHKLDLNTREWTQLKPNNLSCDLPEERYRHEIAHDGQRIYILGGGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP1-77160AF647 0.1 mL

Rabbit Polyclonal PIAS3 Antibody [Alexa Fluor 647]

Sign In for Pricing

View Details

SP-210 10 slides

Sheep Brain, Cerebral Cortex Paraffin Sections

Sign In for Pricing

View Details

orb786412 2 mg

CLPR3 Antibody

Sign In for Pricing

View Details

sc-523685 1 Kit

PDX-1 (B-11) : m-IgGκ BP-HRP Bundle

Sign In for Pricing

View Details

abx007349-01 60 µL

Glutamate Receptor Ionotropic, NMDA 1 (GRIN1) Antibody

Sign In for Pricing

View Details

abx007349-02 120 µL

Glutamate Receptor Ionotropic, NMDA 1 (GRIN1) Antibody

Sign In for Pricing

View Details